PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_1868E2A6C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 266aa    MW: 29733 Da    PI: 8.9146
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_1868E2A6C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++l  ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_5DL_1868E2A6C.1 14 KGAWTKEEDDRLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                           79******************************99************97 PP

2Myb_DNA-binding57.53.2e-1867111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+++ eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Traes_5DL_1868E2A6C.1  67 RGNFSDEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.407961IPR017930Myb domain
SMARTSM007176.3E-131363IPR001005SANT/Myb domain
SuperFamilySSF466898.98E-2913108IPR009057Homeodomain-like
PfamPF002493.1E-141461IPR001005SANT/Myb domain
CDDcd001676.34E-101661No hitNo description
PROSITE profilePS5129428.57562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2765116IPR009057Homeodomain-like
SMARTSM007173.3E-1766114IPR001005SANT/Myb domain
PfamPF002492.6E-1667111IPR001005SANT/Myb domain
CDDcd001671.25E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLTAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SDEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLTSRG  120
IDPVTHRAIN SDHAASNITI SFEAAQRDDK GAVFRRDAEP TKAAAAAITH VDHHHRSNPH  180
HQMDWGQGKP LKCPDLNLDL CISPPSHEDP MVDTKPVVKR EAGAGVGVVG LCFSCSMGLP  240
RSTECKCSSF MGLRTAMLDF RSIEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090840.0BT009084.1 Triticum aestivum clone wkm1c.pk005.f4:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578527.11e-143PREDICTED: myb-related protein Hv1
SwissprotP200261e-175MYB1_HORVU; Myb-related protein Hv1
TrEMBLW5FQS80.0W5FQS8_WHEAT; Uncharacterized protein
STRINGBRADI4G36460.11e-143(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-99myb domain protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]